(data stored in ACNUC7421 zone)

EMBL: CP000272.PE513

CP000272.PE513       Location/Qualifiers
FT   CDS             558638..559255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0541"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36441"
FT                   /db_xref="GOA:Q13HJ8"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ8"
FT                   /protein_id="ABE36441.1"
FT                   /translation="MSDSTTVRLEAFSDGVFAIAITLLVLEIKVPSASDLSQVSGLWHA
FT                   LAERWPSYVGFVASFFIVGVMWANHHALFEYIRRVDRRMLLANLFLLMGVSFLPYPTAV
FT                   LAQNLANPATRTDATVFYGVTLVFTALTYNVVWWLGRYGQARLEPHVHETGLRMITRRY
FT                   NMTLLGSLVATGFAFVNIWLSLVMHLSLYVLSARSEPLKERD"
     MSDSTTVRLE AFSDGVFAIA ITLLVLEIKV PSASDLSQVS GLWHALAERW PSYVGFVASF        60
     FIVGVMWANH HALFEYIRRV DRRMLLANLF LLMGVSFLPY PTAVLAQNLA NPATRTDATV       120
     FYGVTLVFTA LTYNVVWWLG RYGQARLEPH VHETGLRMIT RRYNMTLLGS LVATGFAFVN       180
     IWLSLVMHLS LYVLSARSEP LKERD                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page