(data stored in ACNUC7421 zone)

EMBL: CP000272.PE515

CP000272.PE515       Location/Qualifiers
FT   CDS             complement(560413..561279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0543"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36443"
FT                   /db_xref="GOA:Q13HJ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ6"
FT                   /protein_id="ABE36443.1"
FT                   /translation="MSVHPTSFRWPTSAHGARHADERDEIIEPAVRQPTVVAFNASRTV
FT                   GDHASASKLKNQVLAMVAHELRGPLTPLQLATQLMRRASADRPEVLRSLDMIDRQIAQI
FT                   ARLAQDLMDATRIDRNVLRISRDHLDVVGFLAAPLAAAALATAKRGQTFTLQFADRTLR
FT                   VEGDAVRLAQAIDNLLHNAAKYTPDHGCITVNVHSDGKDLIVSVTDNGLGISRALLPHI
FT                   FDLFAQSSRTIAASAGGLGVGLAVVKAVAESHGGTVSATSAGPGAGSEFTLRLPIVIER
FT                   RGADEPA"
     MSVHPTSFRW PTSAHGARHA DERDEIIEPA VRQPTVVAFN ASRTVGDHAS ASKLKNQVLA        60
     MVAHELRGPL TPLQLATQLM RRASADRPEV LRSLDMIDRQ IAQIARLAQD LMDATRIDRN       120
     VLRISRDHLD VVGFLAAPLA AAALATAKRG QTFTLQFADR TLRVEGDAVR LAQAIDNLLH       180
     NAAKYTPDHG CITVNVHSDG KDLIVSVTDN GLGISRALLP HIFDLFAQSS RTIAASAGGL       240
     GVGLAVVKAV AESHGGTVSA TSAGPGAGSE FTLRLPIVIE RRGADEPA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page