(data stored in ACNUC7421 zone)

EMBL: CP000272.PE516

CP000272.PE516       Location/Qualifiers
FT   CDS             561745..562617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0544"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36444"
FT                   /db_xref="GOA:Q13HJ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ5"
FT                   /protein_id="ABE36444.1"
FT                   /translation="MNPITLFLSVALVLAGAVAGQWLSIYLAPPLIIVGILIGLSVKVA
FT                   NVWEKFVILRLGKLQSVRGAGFFMIIPLLDHIVAIIDERIQTTAFNAEQALTKDTVPVN
FT                   VDAIIFWHVADAKKAALAITDYRQAIDRVSQTTLRELIGSSMLAMLLSDRIYADAHLRD
FT                   VIGSKTAEWGIAVGSVEIRDVAIPVALQDAMSRQAQAEREKQARVILGSAEAAIAANFV
FT                   EAARVYENQPGALQLRAMNIIYETTKERGATILMPTSMVDSLNPALALAIAGRDPATGA
FT                   AVSPLKTAA"
     MNPITLFLSV ALVLAGAVAG QWLSIYLAPP LIIVGILIGL SVKVANVWEK FVILRLGKLQ        60
     SVRGAGFFMI IPLLDHIVAI IDERIQTTAF NAEQALTKDT VPVNVDAIIF WHVADAKKAA       120
     LAITDYRQAI DRVSQTTLRE LIGSSMLAML LSDRIYADAH LRDVIGSKTA EWGIAVGSVE       180
     IRDVAIPVAL QDAMSRQAQA EREKQARVIL GSAEAAIAAN FVEAARVYEN QPGALQLRAM       240
     NIIYETTKER GATILMPTSM VDSLNPALAL AIAGRDPATG AAVSPLKTAA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page