(data stored in ACNUC7421 zone)

EMBL: CP000272.PE518

CP000272.PE518       Location/Qualifiers
FT   CDS             564487..564900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36446"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ3"
FT                   /protein_id="ABE36446.1"
FT                   /translation="MPAHAVRPRTNCPVSNLSLQSGSTLPIAWFPARSISVQTRERVGG
FT                   MINASRRLRSRDFGAAHAIPAVCPSKMASRSIAAAFPDFPGADVCENSFEELERDAQDK
FT                   VQQMHDSKRVRYSRAACVRVCCRISTRRHGRGT"
     MPAHAVRPRT NCPVSNLSLQ SGSTLPIAWF PARSISVQTR ERVGGMINAS RRLRSRDFGA        60
     AHAIPAVCPS KMASRSIAAA FPDFPGADVC ENSFEELERD AQDKVQQMHD SKRVRYSRAA       120
     CVRVCCRIST RRHGRGT                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page