(data stored in SCRATCH zone)

EMBL: CP000272.PE519

CP000272.PE519       Location/Qualifiers
FT   CDS             566352..566681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36447"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ2"
FT                   /protein_id="ABE36447.1"
FT                   /translation="MSKKRTDAELARTQTTQAALVALASHIQTLVADQSLDSRCAAKLV
FT                   RRLKKEAATLEDSSAGTKASRKMLAMTLDALDTALFDQGAMLLVAANATLRADDVSDGA
FT                   TTQRT"
     MSKKRTDAEL ARTQTTQAAL VALASHIQTL VADQSLDSRC AAKLVRRLKK EAATLEDSSA        60
     GTKASRKMLA MTLDALDTAL FDQGAMLLVA ANATLRADDV SDGATTQRT                   109
//

If you have problems or comments...

PBIL Back to PBIL home page