(data stored in SCRATCH zone)

EMBL: CP000272.PE521

CP000272.PE521       Location/Qualifiers
FT   CDS             complement(568328..568627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36449"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HJ0"
FT                   /protein_id="ABE36449.1"
FT                   /translation="MDDGNGIWIFVDIDLTRVTSKSVGIQANLLESLLQQVDARAKERR
FT                   MTRYAFVTLALIDELKQHDNHRLAIQFMNVVAGASLLVAPGVERAIPRHHRGLS"
     MDDGNGIWIF VDIDLTRVTS KSVGIQANLL ESLLQQVDAR AKERRMTRYA FVTLALIDEL        60
     KQHDNHRLAI QFMNVVAGAS LLVAPGVERA IPRHHRGLS                               99
//

If you have problems or comments...

PBIL Back to PBIL home page