(data stored in ACNUC7421 zone)

EMBL: CP000272.PE523

CP000272.PE523       Location/Qualifiers
FT   CDS             571011..572531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0552"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36451"
FT                   /db_xref="GOA:Q13HI8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI8"
FT                   /protein_id="ABE36451.1"
FT                   /translation="MDNTVATAAALPAANAAKRGKYLSVTSIGLMTAAAVVTSLRGLPL
FT                   LAKEEMTMFVYLAFTVVFYLIPASLISAELGGAFADRRGGIYTWVAEAFGTRWGFLAIW
FT                   LQWIQNVVWYPVALTFGAAALAYTIGRPDLAKNGVYVGIFCIVAYWLSTWLVLQGVEVF
FT                   ARIANWTFVIGTIVPGVVLLALLGYWISSGHPLGWQHLNDAALSQGGHARFWPAIHGFG
FT                   TISFLAGIVLLFAGVEVQAVHVIDMRSPSRGYPAAIGLGALISVLIFALGALPIAAILP
FT                   YEKISLQSGVFDAFSAVLVDLWHMGWAVSALSLLVGVGAISGVLAWLGSPSRGLLETAH
FT                   EGELPPILQAKNRKGMPTHILLVQGLIVTVISCFYFVIRDVSVAFFLISAMTIALYLIA
FT                   YMLMYAAAIRLRYSAPALTRPFTVPGGLAGMWLTAGIGFVGVLFSFVVSFFPPDQLPVG
FT                   SPWLYTGLVVLGIVVFAGIPLIIHHVRRSGWATAHDAPLTGPAATPLK"
     MDNTVATAAA LPAANAAKRG KYLSVTSIGL MTAAAVVTSL RGLPLLAKEE MTMFVYLAFT        60
     VVFYLIPASL ISAELGGAFA DRRGGIYTWV AEAFGTRWGF LAIWLQWIQN VVWYPVALTF       120
     GAAALAYTIG RPDLAKNGVY VGIFCIVAYW LSTWLVLQGV EVFARIANWT FVIGTIVPGV       180
     VLLALLGYWI SSGHPLGWQH LNDAALSQGG HARFWPAIHG FGTISFLAGI VLLFAGVEVQ       240
     AVHVIDMRSP SRGYPAAIGL GALISVLIFA LGALPIAAIL PYEKISLQSG VFDAFSAVLV       300
     DLWHMGWAVS ALSLLVGVGA ISGVLAWLGS PSRGLLETAH EGELPPILQA KNRKGMPTHI       360
     LLVQGLIVTV ISCFYFVIRD VSVAFFLISA MTIALYLIAY MLMYAAAIRL RYSAPALTRP       420
     FTVPGGLAGM WLTAGIGFVG VLFSFVVSFF PPDQLPVGSP WLYTGLVVLG IVVFAGIPLI       480
     IHHVRRSGWA TAHDAPLTGP AATPLK                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page