(data stored in ACNUC7421 zone)

EMBL: CP000272.PE525

CP000272.PE525       Location/Qualifiers
FT   CDS             complement(572926..574215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0554"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /function="Natural resistance-associated macrophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36453"
FT                   /db_xref="GOA:Q13HI6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI6"
FT                   /protein_id="ABE36453.1"
FT                   /translation="MDTLTHDPVKQPARPKLLQVMGPGLITGASDDDPSGIATYSQIGA
FT                   QFGYGLAWTLLFSYPLMAAIQEISARIGRVTGSGIAGNLRQHYPRWLSTSVVGMLLVAN
FT                   IINLGADLGAMGSALKLLIAGPALLYVCGFGLLSVVLEIFTRYARYVSILKWLCLSLFS
FT                   YVICAFVVKVPWDQVGRAVLLPALSIKPDYLVAIVAVMGTTISPYLFFWQAEQELEDEK
FT                   ERPGAHPLIHAPWEAPAEFARIRVDTYLGMALSNVVAFFIVVTTATTLHAHGLTNIQTS
FT                   AQAAEGLRAVAGPFTFFVFAAGIIGTGLLTLPVLAGSGAYALGELFAWRVGLARLPSQA
FT                   KAFYGVIAAATAIGAGLNFTSVDPVKALYWSAVLNGVVAVPVMIVMMHLSMRTRIMSGL
FT                   TLPPALRILGWVATGVMAATVVAMGVTWFA"
     MDTLTHDPVK QPARPKLLQV MGPGLITGAS DDDPSGIATY SQIGAQFGYG LAWTLLFSYP        60
     LMAAIQEISA RIGRVTGSGI AGNLRQHYPR WLSTSVVGML LVANIINLGA DLGAMGSALK       120
     LLIAGPALLY VCGFGLLSVV LEIFTRYARY VSILKWLCLS LFSYVICAFV VKVPWDQVGR       180
     AVLLPALSIK PDYLVAIVAV MGTTISPYLF FWQAEQELED EKERPGAHPL IHAPWEAPAE       240
     FARIRVDTYL GMALSNVVAF FIVVTTATTL HAHGLTNIQT SAQAAEGLRA VAGPFTFFVF       300
     AAGIIGTGLL TLPVLAGSGA YALGELFAWR VGLARLPSQA KAFYGVIAAA TAIGAGLNFT       360
     SVDPVKALYW SAVLNGVVAV PVMIVMMHLS MRTRIMSGLT LPPALRILGW VATGVMAATV       420
     VAMGVTWFA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page