(data stored in ACNUC7421 zone)

EMBL: CP000272.PE526

CP000272.PE526       Location/Qualifiers
FT   CDS             complement(574258..574809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0555"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36454"
FT                   /db_xref="GOA:Q13HI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HI5"
FT                   /protein_id="ABE36454.1"
FT                   /translation="MTPYDVVIAVFNDHHQADAAVRKLIDGGFDMKNFSVVGKGYHTEE
FT                   KIVGLYTVGDRMKMWGKYGAFWGGLWGLLMGGVFLTIPALGPIVVLGHLAVVIVSAVEG
FT                   AVVVGTLSALGATLVNVGLPKESVVHYEAAIKADGFIVMAHGTPDEMARAKAVLATHQP
FT                   ARLDLHEGVTPTDAATPETI"
     MTPYDVVIAV FNDHHQADAA VRKLIDGGFD MKNFSVVGKG YHTEEKIVGL YTVGDRMKMW        60
     GKYGAFWGGL WGLLMGGVFL TIPALGPIVV LGHLAVVIVS AVEGAVVVGT LSALGATLVN       120
     VGLPKESVVH YEAAIKADGF IVMAHGTPDE MARAKAVLAT HQPARLDLHE GVTPTDAATP       180
     ETI                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page