(data stored in ACNUC7421 zone)

EMBL: CP000272.PE532

CP000272.PE532       Location/Qualifiers
FT   CDS             580743..581927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0561"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36460"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH9"
FT                   /protein_id="ABE36460.1"
FT                   /translation="MALYSKVLCRLLACVVAATAVTDSTVYADDMKTIDIGMISSRSGV
FT                   YQAFGIPAEDGVRLAVSEINRTGFEVGGQHYKLNLIIRDDRSTEVGATTIATEYVRDQN
FT                   IKFIFGGIGRLAPLIVQITGPEKAIFATASGAAASQFSGKPAGRYLISTLPPIESRARI
FT                   VAEAMRYYFPNAKSVQRLGPQTADNQAIFPLLPEPLRAKGFSNIPDPIYYQPDTTDFSG
FT                   ILTNLKQSRPDVIFLGQLDPARASAIIKQNDDIQATGGWFAWGLDCNANATAGTKTPYV
FT                   GFPTVGAMVDTPQTPQAREFVEKMKKMTGTLPPYLYAATYDYDFVFTLVEAMKKSNTVT
FT                   DTDRIIGALRGLTYNGLVGQITFDAENRAQYGLDACKITSAGVSEVRHFNMSRN"
     MALYSKVLCR LLACVVAATA VTDSTVYADD MKTIDIGMIS SRSGVYQAFG IPAEDGVRLA        60
     VSEINRTGFE VGGQHYKLNL IIRDDRSTEV GATTIATEYV RDQNIKFIFG GIGRLAPLIV       120
     QITGPEKAIF ATASGAAASQ FSGKPAGRYL ISTLPPIESR ARIVAEAMRY YFPNAKSVQR       180
     LGPQTADNQA IFPLLPEPLR AKGFSNIPDP IYYQPDTTDF SGILTNLKQS RPDVIFLGQL       240
     DPARASAIIK QNDDIQATGG WFAWGLDCNA NATAGTKTPY VGFPTVGAMV DTPQTPQARE       300
     FVEKMKKMTG TLPPYLYAAT YDYDFVFTLV EAMKKSNTVT DTDRIIGALR GLTYNGLVGQ       360
     ITFDAENRAQ YGLDACKITS AGVSEVRHFN MSRN                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page