(data stored in SCRATCH zone)

EMBL: CP000272.PE533

CP000272.PE533       Location/Qualifiers
FT   CDS             581940..582812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0562"
FT                   /product="neutral amino acid ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36461"
FT                   /db_xref="GOA:Q13HH8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH8"
FT                   /protein_id="ABE36461.1"
FT                   /translation="MSYIGQQLVNALTLAGLYSLVALGVSLTFGLTRLVNFAHGEILML
FT                   GGYMTFSCMSLGVPFSLALVLAFLGTFLVGLILERSLFRFTLSKPINGFIISLGLIIVI
FT                   QNAVIMFYGSEPQMISSPLKTVWSLDGVRIPSARLVVFIVAAALIAGYLAFTKYSRWGR
FT                   ALRACNEDREGAALLGIPTNRIIMWTFAAGSGVAGLGGGLLAAMLPISAGEGGLVIVKA
FT                   FAIALVGGLGSPNGVVAGSLIVALLETFLPGAVMPVEWAPAVPFILIVIVLLVRPQGLF
FT                   KGGEGSPVS"
     MSYIGQQLVN ALTLAGLYSL VALGVSLTFG LTRLVNFAHG EILMLGGYMT FSCMSLGVPF        60
     SLALVLAFLG TFLVGLILER SLFRFTLSKP INGFIISLGL IIVIQNAVIM FYGSEPQMIS       120
     SPLKTVWSLD GVRIPSARLV VFIVAAALIA GYLAFTKYSR WGRALRACNE DREGAALLGI       180
     PTNRIIMWTF AAGSGVAGLG GGLLAAMLPI SAGEGGLVIV KAFAIALVGG LGSPNGVVAG       240
     SLIVALLETF LPGAVMPVEW APAVPFILIV IVLLVRPQGL FKGGEGSPVS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page