(data stored in ACNUC7421 zone)

EMBL: CP000272.PE536

CP000272.PE536       Location/Qualifiers
FT   CDS             584528..585232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0565"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36464"
FT                   /db_xref="GOA:Q13HH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HH5"
FT                   /protein_id="ABE36464.1"
FT                   /translation="MLDLGNVNVAYGRRPVIHNMHLKVGEGEAVSVLGPNGAGKTTLLR
FT                   AISGMIPVKTGSIRLNSQELANASPNAVARHGVMHVAEGRRLFGNMTCRENLMLGGYMR
FT                   SGPAVNQDFRRLLDVFPEIEPKLDVRAGALSGGQQQMLAIARGLMSRPKILMLDEPTIG
FT                   LSPLVVQRLKTVLTSSAREFFGSLLLVEQDLSLALAVTSRVYVIRNGRIVHEGAVQNIQ
FT                   RENLVEQYFGVA"
     MLDLGNVNVA YGRRPVIHNM HLKVGEGEAV SVLGPNGAGK TTLLRAISGM IPVKTGSIRL        60
     NSQELANASP NAVARHGVMH VAEGRRLFGN MTCRENLMLG GYMRSGPAVN QDFRRLLDVF       120
     PEIEPKLDVR AGALSGGQQQ MLAIARGLMS RPKILMLDEP TIGLSPLVVQ RLKTVLTSSA       180
     REFFGSLLLV EQDLSLALAV TSRVYVIRNG RIVHEGAVQN IQRENLVEQY FGVA             234
//

If you have problems or comments...

PBIL Back to PBIL home page