(data stored in ACNUC7421 zone)

EMBL: CP000272.PE547

CP000272.PE547       Location/Qualifiers
FT   CDS             596650..596856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36475"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG4"
FT                   /protein_id="ABE36475.1"
FT                   /translation="MAAGERFSRDLEKQREVAERAEERLRASEKRALLEIDREQSTATK
FT                   VQKKLDEAVRFLLSWPSALSGMA"
     MAAGERFSRD LEKQREVAER AEERLRASEK RALLEIDREQ STATKVQKKL DEAVRFLLSW        60
     PSALSGMA                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page