(data stored in ACNUC7421 zone)

EMBL: CP000272.PE551

CP000272.PE551       Location/Qualifiers
FT   CDS             complement(600077..601264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0581"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Citation: J. Bacteriol. 182:3784-3793(2000)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36479"
FT                   /db_xref="GOA:Q13HG0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HG0"
FT                   /protein_id="ABE36479.1"
FT                   /translation="MERLFEKNVAITGIGQSEIGRPSNRSAIQLSVDAALEAIADAGLE
FT                   RSDIDGIASWPGDNDNGNPFSPVGPNALMNVLGLNVNWYGAGYEGPGPLTGIVNAAMAI
FT                   ATGLCRHVLVFRTITEATARQRSKSASALTNKTAGRDSSYFWQWYTPFNVISAVNLMAL
FT                   YAQRHFHEYGTTSGQLAQIALTCRSNAALNPKAVMRKPMTMDDYLASNMISSPLRMFDC
FT                   DVHCDASTAIVLSRTDLAREGPHPPIRIEAIGSALHQRWSWDQISLTEMAAFDVGRMMW
FT                   SRTDLKPKDVGTAQLYDGFSILTMLWLEGLGLCPRGESGAFVEGGERISRRGQLPVNTN
FT                   GGQLSGGRTHGLGYVHEACTQLWGRAGERQVAPHDVALAAAGGGPLGASLLLVRE"
     MERLFEKNVA ITGIGQSEIG RPSNRSAIQL SVDAALEAIA DAGLERSDID GIASWPGDND        60
     NGNPFSPVGP NALMNVLGLN VNWYGAGYEG PGPLTGIVNA AMAIATGLCR HVLVFRTITE       120
     ATARQRSKSA SALTNKTAGR DSSYFWQWYT PFNVISAVNL MALYAQRHFH EYGTTSGQLA       180
     QIALTCRSNA ALNPKAVMRK PMTMDDYLAS NMISSPLRMF DCDVHCDAST AIVLSRTDLA       240
     REGPHPPIRI EAIGSALHQR WSWDQISLTE MAAFDVGRMM WSRTDLKPKD VGTAQLYDGF       300
     SILTMLWLEG LGLCPRGESG AFVEGGERIS RRGQLPVNTN GGQLSGGRTH GLGYVHEACT       360
     QLWGRAGERQ VAPHDVALAA AGGGPLGASL LLVRE                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page