(data stored in SCRATCH zone)

EMBL: CP000272.PE552

CP000272.PE552       Location/Qualifiers
FT   CDS             complement(601264..601677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0582"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36480"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF9"
FT                   /protein_id="ABE36480.1"
FT                   /translation="MERKLPSLTPETAPFWQGGSKGVLNIYHCARCERFFHPPAPICPR
FT                   CLSAEVGARPVSGRGHVFSFTVNQQRWTPDLAVPYVVAIVELSEQPGLRFVSNVVGSPV
FT                   DEIHIGMPVRVTFEQIEDVWLPLFELDDERSHA"
     MERKLPSLTP ETAPFWQGGS KGVLNIYHCA RCERFFHPPA PICPRCLSAE VGARPVSGRG        60
     HVFSFTVNQQ RWTPDLAVPY VVAIVELSEQ PGLRFVSNVV GSPVDEIHIG MPVRVTFEQI       120
     EDVWLPLFEL DDERSHA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page