(data stored in ACNUC7421 zone)

EMBL: CP000272.PE556

CP000272.PE556       Location/Qualifiers
FT   CDS             604144..605550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0586"
FT                   /product="Rieske-type ring hydroxylating dioxygenase alpha
FT                   subunit"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36484"
FT                   /db_xref="GOA:Q13HF5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF5"
FT                   /protein_id="ABE36484.1"
FT                   /translation="MLTKSGPTLADGTKVADLVNLETREVQMRTLSDPELYELEMERIF
FT                   GKTWLLLGHESEIPAQGDFMVRDMGSDSVLVTRDKAGEIHVLLNVCSHRGMRVSTVDAG
FT                   NTQIHTCIYHGWAFTTNGSFLGAPVEKECMHGKIRSKAELGLKKARVTLYGGLIFATWN
FT                   IDGPSFEDFLGDAKWYYDMLFQRSDKGLEVLGPPQRFVVRANWKAAGEQSAADGYHTLT
FT                   LHRWLGEVGNYSHVKDKDSGANDLTQQMYGVEISSPHGHALRCQDLARKIRRLTGKEPA
FT                   DLTPEERFRVLPPPGMTADMVPQLLRHLGKEQIDVMASMPPQVGGIFPNVLFAFLYLPQ
FT                   PDGSSLGAIALHTYVPRGPDKLEFTNWVFVEKDTPADVREKMRKQSTQLLGTTGMVEQD
FT                   DSDTWPHMTLAAKGAMGRKMTLKYQAAYETGAPEGWPGPGIVNEGFTKDDTQWHWWQYW
FT                   LELMTADTDA"
     MLTKSGPTLA DGTKVADLVN LETREVQMRT LSDPELYELE MERIFGKTWL LLGHESEIPA        60
     QGDFMVRDMG SDSVLVTRDK AGEIHVLLNV CSHRGMRVST VDAGNTQIHT CIYHGWAFTT       120
     NGSFLGAPVE KECMHGKIRS KAELGLKKAR VTLYGGLIFA TWNIDGPSFE DFLGDAKWYY       180
     DMLFQRSDKG LEVLGPPQRF VVRANWKAAG EQSAADGYHT LTLHRWLGEV GNYSHVKDKD       240
     SGANDLTQQM YGVEISSPHG HALRCQDLAR KIRRLTGKEP ADLTPEERFR VLPPPGMTAD       300
     MVPQLLRHLG KEQIDVMASM PPQVGGIFPN VLFAFLYLPQ PDGSSLGAIA LHTYVPRGPD       360
     KLEFTNWVFV EKDTPADVRE KMRKQSTQLL GTTGMVEQDD SDTWPHMTLA AKGAMGRKMT       420
     LKYQAAYETG APEGWPGPGI VNEGFTKDDT QWHWWQYWLE LMTADTDA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page