(data stored in ACNUC7421 zone)

EMBL: CP000272.PE557

CP000272.PE557       Location/Qualifiers
FT   CDS             605583..606143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0587"
FT                   /product="Rieske-type ring hydroxylating dioxygenase beta
FT                   subunit"
FT                   /note="Citation: J. Bacteriol. 181:2675-2682(1999)."
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36485"
FT                   /db_xref="GOA:Q13HF4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF4"
FT                   /protein_id="ABE36485.1"
FT                   /translation="MSAVNAGIESADVGARVRIGSPVYNGVLEFLYEEAAMLDDLRLQD
FT                   WVATLAEDLIYTAPTRQTRPLAKLEQSVVRTMQHYDDDYRSIRGRVMRLTETKSAWAED
FT                   PPSRTRRLVTNVRVSEAGRPGEYEVRSNLLVTRSRFNFDAFDLVSAERRDLLRAHGESF
FT                   LLARREILLDQVVLGTPNLAIFL"
     MSAVNAGIES ADVGARVRIG SPVYNGVLEF LYEEAAMLDD LRLQDWVATL AEDLIYTAPT        60
     RQTRPLAKLE QSVVRTMQHY DDDYRSIRGR VMRLTETKSA WAEDPPSRTR RLVTNVRVSE       120
     AGRPGEYEVR SNLLVTRSRF NFDAFDLVSA ERRDLLRAHG ESFLLARREI LLDQVVLGTP       180
     NLAIFL                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page