(data stored in ACNUC7421 zone)

EMBL: CP000272.PE560

CP000272.PE560       Location/Qualifiers
FT   CDS             complement(607495..608226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0590"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36488"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HF1"
FT                   /protein_id="ABE36488.1"
FT                   /translation="MFRRRIIISNRTDGSQTVTRAALEDDFHHFRVEVTGIGGRVSKIG
FT                   GEAPRKPYTLCSQAIGQLEALIGMPLAGNSHEVTRITDPTVQCTHLLELAGLAIAAASR
FT                   GTPRRQYDVAVPARVADRTHPTLARDGIPCLEWNVAGSVIEGPAPYAGVSLYHGMARWA
FT                   LSTLDAEQAEAALVLRRGTGISRGRGMNLDAQVHAQPAGNCFVQQPQRAPQAIRVVGST
FT                   LDFAARPADLCADDLAWLAFA"
     MFRRRIIISN RTDGSQTVTR AALEDDFHHF RVEVTGIGGR VSKIGGEAPR KPYTLCSQAI        60
     GQLEALIGMP LAGNSHEVTR ITDPTVQCTH LLELAGLAIA AASRGTPRRQ YDVAVPARVA       120
     DRTHPTLARD GIPCLEWNVA GSVIEGPAPY AGVSLYHGMA RWALSTLDAE QAEAALVLRR       180
     GTGISRGRGM NLDAQVHAQP AGNCFVQQPQ RAPQAIRVVG STLDFAARPA DLCADDLAWL       240
     AFA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page