(data stored in SCRATCH zone)

EMBL: CP000272.PE592

CP000272.PE592       Location/Qualifiers
FT   CDS             646149..647093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0622"
FT                   /product="Putative Rieske (2Fe-2S) protein"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36520"
FT                   /db_xref="GOA:Q13HB9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB9"
FT                   /protein_id="ABE36520.1"
FT                   /translation="MTTGSWWAAALAESVDASRPLAVVCNGEALVLFRDASGAACALED
FT                   RCPHRRVPLALGKVTPKGLQCGYHGWTFDGKTGACTAIPNLSADERVPPRYGARSYRVA
FT                   EASGFIHVWLGDGEPDDARLPGSLYHPQGEEHTGASIVNVAAHEYLDAMLDGPDCLVSF
FT                   DGVRITDFFLGDARTGDGWLTVDRGAVWKTRMLPPAFVTDHPLIVRTSVSLAGGAALVG
FT                   LLDADETPLVTVFVASSANRRGTTSLCWRGFRHDARVASAPLRWQIARATGRAPFTVRE
FT                   QIDGAALAALLVAPSRDLAAARTAIRAPIASIA"
     MTTGSWWAAA LAESVDASRP LAVVCNGEAL VLFRDASGAA CALEDRCPHR RVPLALGKVT        60
     PKGLQCGYHG WTFDGKTGAC TAIPNLSADE RVPPRYGARS YRVAEASGFI HVWLGDGEPD       120
     DARLPGSLYH PQGEEHTGAS IVNVAAHEYL DAMLDGPDCL VSFDGVRITD FFLGDARTGD       180
     GWLTVDRGAV WKTRMLPPAF VTDHPLIVRT SVSLAGGAAL VGLLDADETP LVTVFVASSA       240
     NRRGTTSLCW RGFRHDARVA SAPLRWQIAR ATGRAPFTVR EQIDGAALAA LLVAPSRDLA       300
     AARTAIRAPI ASIA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page