(data stored in ACNUC7421 zone)

EMBL: CP000272.PE6

CP000272.PE6         Location/Qualifiers
FT   CDS             7222..8178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0006"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35934"
FT                   /db_xref="GOA:Q13J05"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J05"
FT                   /protein_id="ABE35934.1"
FT                   /translation="MILSLNVLFWLLGILLVVIGGLIVGDRAHPKRFFAGGFWIVYGLI
FT                   FLVGDRLPADVVGVLVVAMALVAGFGGVVGARPRLRSDDERRASAQRLGNQLFLPALTI
FT                   PFVTVIGTLLTPHLVFGGIALIDPKNATLVSFGVGCVVALVLACRLTRDTLGQAVKEAR
FT                   RLVDSLSWAVVLPQMLGMLGLVFADAGVGKAVAHLTTSYIDLDYRFVAVVVYCAGMALF
FT                   TIIMGNGFAAFPVMTGGVGVPVLIGVFHGNPAPMVAIGMFSGYCGTLLTPMAANYNIVP
FT                   AALLELPDKYGVIRAQVPTALVLLVINIFLLNTLMYI"
     MILSLNVLFW LLGILLVVIG GLIVGDRAHP KRFFAGGFWI VYGLIFLVGD RLPADVVGVL        60
     VVAMALVAGF GGVVGARPRL RSDDERRASA QRLGNQLFLP ALTIPFVTVI GTLLTPHLVF       120
     GGIALIDPKN ATLVSFGVGC VVALVLACRL TRDTLGQAVK EARRLVDSLS WAVVLPQMLG       180
     MLGLVFADAG VGKAVAHLTT SYIDLDYRFV AVVVYCAGMA LFTIIMGNGF AAFPVMTGGV       240
     GVPVLIGVFH GNPAPMVAIG MFSGYCGTLL TPMAANYNIV PAALLELPDK YGVIRAQVPT       300
     ALVLLVINIF LLNTLMYI                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page