(data stored in ACNUC7421 zone)

EMBL: CP000272.PE600

CP000272.PE600       Location/Qualifiers
FT   CDS             complement(652804..653835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36528"
FT                   /db_xref="UniProtKB/TrEMBL:Q13HB1"
FT                   /protein_id="ABE36528.1"
FT                   /translation="MKSFKTVPQRGDFRYQTLVAPHKVSGRAMHDLRGFYGLQLTKGMP
FT                   FGCVRDEDGEIYAFVRAVNEPGSTPNPTRFIYLSTRVDGQHLRIDKSRIEPRATTLFPR
FT                   RWLEGDTACWSSLEGEPGAGWQLSASGERLSWTEEGLFELGGPLLGQGMQWYLPGVDWG
FT                   TFYVSQIYDIAGICDGRRVKGLMCFDQAYMAEGGAIHFSKDLVVNHQMHVIWWSFATVY
FT                   KDGSWDVGSFMVGHDHLGYAIFQNDKGEIRTTTDIDGRVQHKDGSYFVESARIVLDGEE
FT                   EWEFLPCPKGEMIDFVGGFPITAQQEGRWRRVGDTREADRWVGWGESDRRNGTARNVRG
FT                   IQP"
     MKSFKTVPQR GDFRYQTLVA PHKVSGRAMH DLRGFYGLQL TKGMPFGCVR DEDGEIYAFV        60
     RAVNEPGSTP NPTRFIYLST RVDGQHLRID KSRIEPRATT LFPRRWLEGD TACWSSLEGE       120
     PGAGWQLSAS GERLSWTEEG LFELGGPLLG QGMQWYLPGV DWGTFYVSQI YDIAGICDGR       180
     RVKGLMCFDQ AYMAEGGAIH FSKDLVVNHQ MHVIWWSFAT VYKDGSWDVG SFMVGHDHLG       240
     YAIFQNDKGE IRTTTDIDGR VQHKDGSYFV ESARIVLDGE EEWEFLPCPK GEMIDFVGGF       300
     PITAQQEGRW RRVGDTREAD RWVGWGESDR RNGTARNVRG IQP                         343
//

If you have problems or comments...

PBIL Back to PBIL home page