(data stored in SCRATCH zone)

EMBL: CP000272.PE618

CP000272.PE618       Location/Qualifiers
FT   CDS             complement(673699..675405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36546"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H93"
FT                   /protein_id="ABE36546.1"
FT                   /translation="MNGMTSRARLKRNRVSVGVAAALGCWAASASAMPLGAIPDWDINW
FT                   DNTISYNIGMRAQGINPNIGNNPTFSESDYKFAHAGDIVTNRVSDLSEFDAVFQNKFGF
FT                   RVSASFWKDFAYGGGVSNNPGMAYPGTPYSTLNSYANNRYSSYTERYYQQGAELLDAFV
FT                   FYNFNLGSAPSSIKVGRLTQYWGNALFFSGIAYGQNAIDGIKGAAVPGTQLKELTVPRA
FT                   QVLFQTNITPTVSLAAQYFAEYKPSMFPQGGTYLGTAGFLFQGPNLLDGQIPQGAPVQP
FT                   TNGFHSDYGLKATWSPTWLNGTMGFYYRNLTETNPWVLLGVNPATGATNYHLGYASDVK
FT                   LYGFSLDKQIGPYSTGLDVSYRHNTALNSSTGPLPGDLSGQAGARGDVLNVIGNVMAGL
FT                   TRTPLWDTGSAVVELGYTQKLKTTSNGALYNGVGNSLACPGGNKWDGCSTNSAVAIAVQ
FT                   FDPQWLQVYPGIDLDMPIFLEYGIWGNQATVEPSPGQGTLQYTIGVHALIQNKYNVTLQ
FT                   YNGYHAHAGGQTNFGLANGLPGGGPSYYAGGNSTYFYNDRGWVSLTFSAAF"
     MNGMTSRARL KRNRVSVGVA AALGCWAASA SAMPLGAIPD WDINWDNTIS YNIGMRAQGI        60
     NPNIGNNPTF SESDYKFAHA GDIVTNRVSD LSEFDAVFQN KFGFRVSASF WKDFAYGGGV       120
     SNNPGMAYPG TPYSTLNSYA NNRYSSYTER YYQQGAELLD AFVFYNFNLG SAPSSIKVGR       180
     LTQYWGNALF FSGIAYGQNA IDGIKGAAVP GTQLKELTVP RAQVLFQTNI TPTVSLAAQY       240
     FAEYKPSMFP QGGTYLGTAG FLFQGPNLLD GQIPQGAPVQ PTNGFHSDYG LKATWSPTWL       300
     NGTMGFYYRN LTETNPWVLL GVNPATGATN YHLGYASDVK LYGFSLDKQI GPYSTGLDVS       360
     YRHNTALNSS TGPLPGDLSG QAGARGDVLN VIGNVMAGLT RTPLWDTGSA VVELGYTQKL       420
     KTTSNGALYN GVGNSLACPG GNKWDGCSTN SAVAIAVQFD PQWLQVYPGI DLDMPIFLEY       480
     GIWGNQATVE PSPGQGTLQY TIGVHALIQN KYNVTLQYNG YHAHAGGQTN FGLANGLPGG       540
     GPSYYAGGNS TYFYNDRGWV SLTFSAAF                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page