(data stored in ACNUC7421 zone)

EMBL: CP000272.PE626

CP000272.PE626       Location/Qualifiers
FT   CDS             complement(685485..686321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0656"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36554"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H85"
FT                   /protein_id="ABE36554.1"
FT                   /translation="MNDETISIEDVVTLAPASALEATLDHPVSLRTGDALPPLWHWLYF
FT                   WPRARQSALGADGHPLKGSFLPDLGLPRRMWAGGRLRFIAPIAIGEAIMRRSAVTSFTE
FT                   KAGRSGRLGFVTVRHEIAGAKGLLIDEEQHIVYREPPQPGSSAPAPIPARTDATWRRLI
FT                   EPDETLLFRYSALTFNAHRIHYDRTYVTQVEGYPDLVVHGPLQAALLADLVQRHLPGRA
FT                   FETFLFRAVRPLFLGQPFSVCGRPAADGSTVELWVSDHEGALTMSAQATLAGASRA"
     MNDETISIED VVTLAPASAL EATLDHPVSL RTGDALPPLW HWLYFWPRAR QSALGADGHP        60
     LKGSFLPDLG LPRRMWAGGR LRFIAPIAIG EAIMRRSAVT SFTEKAGRSG RLGFVTVRHE       120
     IAGAKGLLID EEQHIVYREP PQPGSSAPAP IPARTDATWR RLIEPDETLL FRYSALTFNA       180
     HRIHYDRTYV TQVEGYPDLV VHGPLQAALL ADLVQRHLPG RAFETFLFRA VRPLFLGQPF       240
     SVCGRPAADG STVELWVSDH EGALTMSAQA TLAGASRA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page