(data stored in SCRATCH zone)

EMBL: CP000272.PE63

CP000272.PE63        Location/Qualifiers
FT   CDS             73245..74030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0064"
FT                   /product="ectoine ABC transporter ATP-binding protein /
FT                   hydroxyectoine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35991"
FT                   /db_xref="GOA:Q13IU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU8"
FT                   /protein_id="ABE35991.1"
FT                   /translation="MIKPLIRIDRITKRYGPLTVLDELSLDVMPGEKLALIGPSGSGKT
FT                   TILRILMTLESIDGGHVEIDGEQLFHMQQGGRTVPANERHLQMMRGKVGMVFQHFNLFP
FT                   HKSVLDNVTLAPILTKGESRETAEKRALELLDMVGMADKAKSRPAQLSGGQKQRVAIAR
FT                   ALALAPRIMLFDEVTSALDPELVEEVLNVMHRLARETDMTMLLVTHEMGFAHDFADRVL
FT                   FFDRGRIVEEGKPEDIFSHPEHERTQAFLRKIIAAGHRL"
     MIKPLIRIDR ITKRYGPLTV LDELSLDVMP GEKLALIGPS GSGKTTILRI LMTLESIDGG        60
     HVEIDGEQLF HMQQGGRTVP ANERHLQMMR GKVGMVFQHF NLFPHKSVLD NVTLAPILTK       120
     GESRETAEKR ALELLDMVGM ADKAKSRPAQ LSGGQKQRVA IARALALAPR IMLFDEVTSA       180
     LDPELVEEVL NVMHRLARET DMTMLLVTHE MGFAHDFADR VLFFDRGRIV EEGKPEDIFS       240
     HPEHERTQAF LRKIIAAGHR L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page