(data stored in ACNUC7421 zone)

EMBL: CP000272.PE646

CP000272.PE646       Location/Qualifiers
FT   CDS             complement(707568..708101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36574"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H65"
FT                   /protein_id="ABE36574.1"
FT                   /translation="MTTATTSTPSTRDEKRSTTVVEGRQHDLAGGAGAAGDCAVAGLCF
FT                   SSSYRGGIIKAADERACGAHDGPAGCCPAAVGSGPDNVKAMLVYWKLMNALPGHEAFTR
FT                   FGPADPRVDMTTLRKNVGALPVEPAEQNAFWYKLYRRVESEVPVVDARKMYLLWRDAAA
FT                   LSLPLVIALPLLLR"
     MTTATTSTPS TRDEKRSTTV VEGRQHDLAG GAGAAGDCAV AGLCFSSSYR GGIIKAADER        60
     ACGAHDGPAG CCPAAVGSGP DNVKAMLVYW KLMNALPGHE AFTRFGPADP RVDMTTLRKN       120
     VGALPVEPAE QNAFWYKLYR RVESEVPVVD ARKMYLLWRD AAALSLPLVI ALPLLLR          177
//

If you have problems or comments...

PBIL Back to PBIL home page