(data stored in ACNUC7421 zone)

EMBL: CP000272.PE647

CP000272.PE647       Location/Qualifiers
FT   CDS             complement(708061..708522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36575"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H64"
FT                   /protein_id="ABE36575.1"
FT                   /translation="MGGITMSAFWNTYPQFIDTNNLSLAVFIKYRWFKILFAGDLEKAG
FT                   WRALLQQASFRAELAGTEVLVASHHGRENGFCEDIFAYFTPSCVVISDKAIVHATQETV
FT                   PDYRAVVRKQGAYVNTTGKRRHVLTTRRDGWIQFTVLDNGYNIDTEYKG"
     MGGITMSAFW NTYPQFIDTN NLSLAVFIKY RWFKILFAGD LEKAGWRALL QQASFRAELA        60
     GTEVLVASHH GRENGFCEDI FAYFTPSCVV ISDKAIVHAT QETVPDYRAV VRKQGAYVNT       120
     TGKRRHVLTT RRDGWIQFTV LDNGYNIDTE YKG                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page