(data stored in ACNUC7421 zone)

EMBL: CP000272.PE649

CP000272.PE649       Location/Qualifiers
FT   CDS             complement(708971..709408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0679"
FT                   /product="Putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36577"
FT                   /db_xref="GOA:Q13H62"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H62"
FT                   /protein_id="ABE36577.1"
FT                   /translation="MFVLDTNVVSELRKAKAGKADRNVAFWAASVSPGALFLSAITILE
FT                   FETGVLLMERRDATQGAILRAWLDSHVLPAFAGRVLAVDIAVAQRCARLHVPDQRAERD
FT                   ALIAATALVHGMTVVTRNVGDFVQTGVDILNPWEPIGIHHD"
     MFVLDTNVVS ELRKAKAGKA DRNVAFWAAS VSPGALFLSA ITILEFETGV LLMERRDATQ        60
     GAILRAWLDS HVLPAFAGRV LAVDIAVAQR CARLHVPDQR AERDALIAAT ALVHGMTVVT       120
     RNVGDFVQTG VDILNPWEPI GIHHD                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page