(data stored in ACNUC7421 zone)

EMBL: CP000272.PE65

CP000272.PE65        Location/Qualifiers
FT   CDS             75004..75663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0066"
FT                   /product="hydroxyectoine ABC transporter membrane protein /
FT                   ectoine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35993"
FT                   /db_xref="GOA:Q13IU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU6"
FT                   /protein_id="ABE35993.1"
FT                   /translation="MNDWSGYLLLILKGAQTTVELTVMGAALALVMAFVAGLGRLSRFT
FT                   AVRALATSYIEFFRGTSVFVQLFWAYFVLPMVGLTLTPLQAGVLALGLNVGAYGAEVVR
FT                   GAVVAVGQEQRSACVALNLSSYQRMRHVILPQALPLMLPTFGNNAIELLKGTAVVSLIS
FT                   LGDMTFQAQVVRSQTGNTLIPFATILALYFAMACLIALGVRKLERRMSFGLDRMRR"
     MNDWSGYLLL ILKGAQTTVE LTVMGAALAL VMAFVAGLGR LSRFTAVRAL ATSYIEFFRG        60
     TSVFVQLFWA YFVLPMVGLT LTPLQAGVLA LGLNVGAYGA EVVRGAVVAV GQEQRSACVA       120
     LNLSSYQRMR HVILPQALPL MLPTFGNNAI ELLKGTAVVS LISLGDMTFQ AQVVRSQTGN       180
     TLIPFATILA LYFAMACLIA LGVRKLERRM SFGLDRMRR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page