(data stored in ACNUC7421 zone)

EMBL: CP000272.PE650

CP000272.PE650       Location/Qualifiers
FT   CDS             complement(709408..709662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0680"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36578"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H61"
FT                   /protein_id="ABE36578.1"
FT                   /translation="MTITTLSSREFNQDASGAKKAANEGPVFITDRGRPAHVLLSIAEY
FT                   QKLIGGPASIIDMLAMPGVEQIEFDPPRAGTLSRPADLS"
     MTITTLSSRE FNQDASGAKK AANEGPVFIT DRGRPAHVLL SIAEYQKLIG GPASIIDMLA        60
     MPGVEQIEFD PPRAGTLSRP ADLS                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page