(data stored in SCRATCH zone)

EMBL: CP000272.PE654

CP000272.PE654       Location/Qualifiers
FT   CDS             712327..712992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0684"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36582"
FT                   /db_xref="GOA:Q13H57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H57"
FT                   /protein_id="ABE36582.1"
FT                   /translation="MNYHFHWGIVGQNLGYLLHGIWLTLAVTAVSLAVAIVIGLVIGIM
FT                   RISSKGVLKRVAGVYVEVFRNTPTLVQLIWVYYCLPVLTGINLSPTSSCIFALSINSAA
FT                   YVAEIFRAGIQAVPSGQLEAARSIGMSYSKAMRKIILPQAVRQMIPPFVNEFVSLLKYS
FT                   SLVSVLGVADLTYQAQTLSTTTFRPIEIFTFIGVVYFLLCWAISAAAHVLEQKIRVIA"
     MNYHFHWGIV GQNLGYLLHG IWLTLAVTAV SLAVAIVIGL VIGIMRISSK GVLKRVAGVY        60
     VEVFRNTPTL VQLIWVYYCL PVLTGINLSP TSSCIFALSI NSAAYVAEIF RAGIQAVPSG       120
     QLEAARSIGM SYSKAMRKII LPQAVRQMIP PFVNEFVSLL KYSSLVSVLG VADLTYQAQT       180
     LSTTTFRPIE IFTFIGVVYF LLCWAISAAA HVLEQKIRVI A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page