(data stored in ACNUC7421 zone)

EMBL: CP000272.PE655

CP000272.PE655       Location/Qualifiers
FT   CDS             712989..713735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0685"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36583"
FT                   /db_xref="GOA:Q13H56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H56"
FT                   /protein_id="ABE36583.1"
FT                   /translation="MRHSPGDEPMVSIQGLKKRFGDHAVLKGVDLTVSKGEVLVIIGAS
FT                   GSGKSTLLRCINLMEVPDHGQVSVGGEPMGEMAGDGRFRMFPERIVNARRARIGMVFQH
FT                   FNLFAHLRVIDNVTIGPVEVNRMSRIDARELGMAMLEKVGMAAKADAFPSQLSGGQKQR
FT                   VAIARALAMRPRLILFDEPTSALDGGMPNRPETFYRQGSEKSPFRYPYFYPYSKGPVFP
FT                   LSRRSDPDFNPPKYGSNPNSTPPTDR"
     MRHSPGDEPM VSIQGLKKRF GDHAVLKGVD LTVSKGEVLV IIGASGSGKS TLLRCINLME        60
     VPDHGQVSVG GEPMGEMAGD GRFRMFPERI VNARRARIGM VFQHFNLFAH LRVIDNVTIG       120
     PVEVNRMSRI DARELGMAML EKVGMAAKAD AFPSQLSGGQ KQRVAIARAL AMRPRLILFD       180
     EPTSALDGGM PNRPETFYRQ GSEKSPFRYP YFYPYSKGPV FPLSRRSDPD FNPPKYGSNP       240
     NSTPPTDR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page