(data stored in ACNUC7421 zone)

EMBL: CP000272.PE656

CP000272.PE656       Location/Qualifiers
FT   CDS             complement(713988..714131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0686"
FT                   /product="Putative PIN (PilT N terminus) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36584"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H55"
FT                   /protein_id="ABE36584.1"
FT                   /translation="MIVLDTNVLSEMLRRLPGVEVMAWLAAQPRAALFTTTVIRADILY
FT                   GL"
     MIVLDTNVLS EMLRRLPGVE VMAWLAAQPR AALFTTTVIR ADILYGL                      47
//

If you have problems or comments...

PBIL Back to PBIL home page