(data stored in ACNUC7421 zone)

EMBL: CP000272.PE657

CP000272.PE657       Location/Qualifiers
FT   CDS             complement(714118..714429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36585"
FT                   /db_xref="GOA:Q13H54"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H54"
FT                   /protein_id="ABE36585.1"
FT                   /translation="MKIMPSLIKVPPMTEAKMSSTTTRDIGEQLKARLRGEAAQHGLSI
FT                   GDEARDSLRAALSTDSIDLQHNLAESIRSRIEPLGGIDLEFPPRDGFGKEWTAAHDRS"
     MKIMPSLIKV PPMTEAKMSS TTTRDIGEQL KARLRGEAAQ HGLSIGDEAR DSLRAALSTD        60
     SIDLQHNLAE SIRSRIEPLG GIDLEFPPRD GFGKEWTAAH DRS                         103
//

If you have problems or comments...

PBIL Back to PBIL home page