(data stored in ACNUC7421 zone)

EMBL: CP000272.PE659

CP000272.PE659       Location/Qualifiers
FT   CDS             complement(715347..715745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36587"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H52"
FT                   /protein_id="ABE36587.1"
FT                   /translation="MSSDDNIQAMTDRDHSLDTLLELDGVMYTVDDTGCCWVKFEVARI
FT                   AVSPERPHGLKYSLTLHDEKGTRLLGFDNAHPVRDGCRPRRTDADRVRPQARWRAHPVL
FT                   RLHGCRETACRLLDRSRTVMKERSESDD"
     MSSDDNIQAM TDRDHSLDTL LELDGVMYTV DDTGCCWVKF EVARIAVSPE RPHGLKYSLT        60
     LHDEKGTRLL GFDNAHPVRD GCRPRRTDAD RVRPQARWRA HPVLRLHGCR ETACRLLDRS       120
     RTVMKERSES DD                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page