(data stored in SCRATCH zone)

EMBL: CP000272.PE660

CP000272.PE660       Location/Qualifiers
FT   CDS             715860..716531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36588"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H51"
FT                   /protein_id="ABE36588.1"
FT                   /translation="MPVIRIAVDEDDPDAGRYAAAVMAATLAMAAEPLPELPAQGKQSK
FT                   PEKPLPENKHQLTRKQHVFPVRSIERFVDQGGRVAVFDMLRVKERPARPEDIVFCARRA
FT                   WDQQTEDDMTQIENRFQEVVQPITEGLINTIAPEHKPAIDAMFALWVMRTRFRGLAAQE
FT                   LQLFGVPAYDMSKARAEHLESADRVFVRKGGKVPTRQINGAQLRMRVSGYTRDLAAALG
FT                   G"
     MPVIRIAVDE DDPDAGRYAA AVMAATLAMA AEPLPELPAQ GKQSKPEKPL PENKHQLTRK        60
     QHVFPVRSIE RFVDQGGRVA VFDMLRVKER PARPEDIVFC ARRAWDQQTE DDMTQIENRF       120
     QEVVQPITEG LINTIAPEHK PAIDAMFALW VMRTRFRGLA AQELQLFGVP AYDMSKARAE       180
     HLESADRVFV RKGGKVPTRQ INGAQLRMRV SGYTRDLAAA LGG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page