(data stored in ACNUC7421 zone)

EMBL: CP000272.PE666

CP000272.PE666       Location/Qualifiers
FT   CDS             complement(724631..726628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0789"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36594"
FT                   /db_xref="GOA:Q13H45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H45"
FT                   /protein_id="ABE36594.1"
FT                   /translation="MKAHLFRRAHAAFMARSGGAPLPSSNLVEVRGLRVVGSRAGEPDT
FT                   TIVHDIDFEIARGEVLALIGESGSGKTTIALSLMGHARSGCRIAGGAIQVGDTDVLGLS
FT                   PIALADLRGRKVAYIAQSAAAAFNPARTIMDQVIESALIHGTLAKRAAQEKAVELFRAL
FT                   ALPEPETIGRRYPHQVSGGQLQRLMAAMALITDPELVILDEPTTALDVTTQIDVLQAFR
FT                   RVIRQCGMTAVYVSHDLAVVAQMADRIVVLSNGEIRETGRTEQILHAPAHPYTQSLIAA
FT                   VTPVMPDMPFAPVPAGTAATAVADGSALQPRPAAAPLLELRRLTAGYGGTNAKGWPNKV
FT                   ILNDVDLVIGRGQTVGVIGESGSGKTTLAKVIAGLVPMARGTLLLDGKPLAADLRRRSR
FT                   EQFRCIHIVFQNADTALNPTHTVERTLARPLKFYHGMKGDAAKRRVAELLNLVRLPAEL
FT                   AQRRTGELSGGQKQRVNLARALAAEPQLILCDEVTSALDTVVGAAILELLRDLQKKLGV
FT                   SYLFITHDIAKVRAISDDIVVLYAGHRVETGTRDALSAPPYHPYSHLLVSSAPELRAGW
FT                   LEEADERCHRALPPIGEATHEPELCTFLARCPMRIDGVCNRTAPTERTLASGAQVLCHR
FT                   SEAELEQYQSMPGDDAAAVAVLAESASVRG"
     MKAHLFRRAH AAFMARSGGA PLPSSNLVEV RGLRVVGSRA GEPDTTIVHD IDFEIARGEV        60
     LALIGESGSG KTTIALSLMG HARSGCRIAG GAIQVGDTDV LGLSPIALAD LRGRKVAYIA       120
     QSAAAAFNPA RTIMDQVIES ALIHGTLAKR AAQEKAVELF RALALPEPET IGRRYPHQVS       180
     GGQLQRLMAA MALITDPELV ILDEPTTALD VTTQIDVLQA FRRVIRQCGM TAVYVSHDLA       240
     VVAQMADRIV VLSNGEIRET GRTEQILHAP AHPYTQSLIA AVTPVMPDMP FAPVPAGTAA       300
     TAVADGSALQ PRPAAAPLLE LRRLTAGYGG TNAKGWPNKV ILNDVDLVIG RGQTVGVIGE       360
     SGSGKTTLAK VIAGLVPMAR GTLLLDGKPL AADLRRRSRE QFRCIHIVFQ NADTALNPTH       420
     TVERTLARPL KFYHGMKGDA AKRRVAELLN LVRLPAELAQ RRTGELSGGQ KQRVNLARAL       480
     AAEPQLILCD EVTSALDTVV GAAILELLRD LQKKLGVSYL FITHDIAKVR AISDDIVVLY       540
     AGHRVETGTR DALSAPPYHP YSHLLVSSAP ELRAGWLEEA DERCHRALPP IGEATHEPEL       600
     CTFLARCPMR IDGVCNRTAP TERTLASGAQ VLCHRSEAEL EQYQSMPGDD AAAVAVLAES       660
     ASVRG                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page