(data stored in ACNUC7421 zone)

EMBL: CP000272.PE667

CP000272.PE667       Location/Qualifiers
FT   CDS             complement(726628..727620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0788"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36595"
FT                   /db_xref="GOA:Q13H44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H44"
FT                   /protein_id="ABE36595.1"
FT                   /translation="MTILPPSSQTPHRLGALEPVHRSSMLPQGTEPGRPWGSGGGPAPQ
FT                   RVRRRSVAQRMNLSTGGWIGLAMVGSALFVAAFAPWIAPHPVGAILTPDVFAGFSAKLP
FT                   LGSDYLGRDMLTRIIYGMRLTVVLALAAALLAALTGTMLGLLAAVAGRRIDETMSRLLD
FT                   AVTSIPSKMFALMIVAAFGSSLPLLIMTAAVSYMPGSYRIARSLAVNIGTLEYVQVAQA
FT                   RGESALYIACFEMLPNMIHPMLTDTGLRFTFVVLLLSSLSFLGLGVQPPYADLGSLVRE
FT                   NIAGLGEGVPVVILPAIAIAVLTVGVNLLIDGLPHRGRLKGAADADGGH"
     MTILPPSSQT PHRLGALEPV HRSSMLPQGT EPGRPWGSGG GPAPQRVRRR SVAQRMNLST        60
     GGWIGLAMVG SALFVAAFAP WIAPHPVGAI LTPDVFAGFS AKLPLGSDYL GRDMLTRIIY       120
     GMRLTVVLAL AAALLAALTG TMLGLLAAVA GRRIDETMSR LLDAVTSIPS KMFALMIVAA       180
     FGSSLPLLIM TAAVSYMPGS YRIARSLAVN IGTLEYVQVA QARGESALYI ACFEMLPNMI       240
     HPMLTDTGLR FTFVVLLLSS LSFLGLGVQP PYADLGSLVR ENIAGLGEGV PVVILPAIAI       300
     AVLTVGVNLL IDGLPHRGRL KGAADADGGH                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page