(data stored in ACNUC7421 zone)

EMBL: CP000272.PE669

CP000272.PE669       Location/Qualifiers
FT   CDS             complement(728685..730265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0786"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36597"
FT                   /db_xref="GOA:Q13H42"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H42"
FT                   /protein_id="ABE36597.1"
FT                   /translation="MYDDEIKKGGFSRRDMMRLLAAGGMLATGAGGLLAAANPAFAAPT
FT                   PKKGGKIRVAYDASSTADTLDPAKGSAGSDYIRFFMFYSSLTQLDASLTPQMNLAESVD
FT                   SSDAKVWVIKLRKGVIFHDGKALAPADVVYSLMRHKNPATASKVKTLADQFVDAKQTGP
FT                   NEVTLTLTSANADLPVILATPQFVIVKDGTTDFTTAVGTGPYKVKTFKPGVSTVGVRND
FT                   SFWKTGAGPYLDQIELIGIGDDAARVNALLSGDVHLINSVDPRSTQRISATPGYEVRET
FT                   KSGLYTDLIMRRDNPMSGNPDFVQGMKYLFDRDQVRSAVFRGYAVIGNDQPIPPGHRYF
FT                   NASLPQRPHDPDKAKFHFQKAGAIGTTLPPIYATTDANGSVEMGELLQQSAAKIGVNLN
FT                   INRVPADGYWSNHWMKHPLGFGSVNPRPSADVLFTQFFKSDAPWNESGWNNPKFDQLLG
FT                   AARSETDDAKRKQMYGDMQVLVSEHGGIGIPTFLSLLDANDKKLQGLAPVPTGAMMGFN
FT                   FAEYVWWNA"
     MYDDEIKKGG FSRRDMMRLL AAGGMLATGA GGLLAAANPA FAAPTPKKGG KIRVAYDASS        60
     TADTLDPAKG SAGSDYIRFF MFYSSLTQLD ASLTPQMNLA ESVDSSDAKV WVIKLRKGVI       120
     FHDGKALAPA DVVYSLMRHK NPATASKVKT LADQFVDAKQ TGPNEVTLTL TSANADLPVI       180
     LATPQFVIVK DGTTDFTTAV GTGPYKVKTF KPGVSTVGVR NDSFWKTGAG PYLDQIELIG       240
     IGDDAARVNA LLSGDVHLIN SVDPRSTQRI SATPGYEVRE TKSGLYTDLI MRRDNPMSGN       300
     PDFVQGMKYL FDRDQVRSAV FRGYAVIGND QPIPPGHRYF NASLPQRPHD PDKAKFHFQK       360
     AGAIGTTLPP IYATTDANGS VEMGELLQQS AAKIGVNLNI NRVPADGYWS NHWMKHPLGF       420
     GSVNPRPSAD VLFTQFFKSD APWNESGWNN PKFDQLLGAA RSETDDAKRK QMYGDMQVLV       480
     SEHGGIGIPT FLSLLDANDK KLQGLAPVPT GAMMGFNFAE YVWWNA                      526
//

If you have problems or comments...

PBIL Back to PBIL home page