(data stored in SCRATCH zone)

EMBL: CP000272.PE676

CP000272.PE676       Location/Qualifiers
FT   CDS             complement(737106..737417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0779"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36604"
FT                   /db_xref="GOA:Q13H35"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H35"
FT                   /protein_id="ABE36604.1"
FT                   /translation="MSGRFVRIGETARATVELTIDGEHVAALAGDTLLTAMLCSVRHVR
FT                   QSEFGNERRAGFCLMGACQDCWVWTADGERLRACTTVVEAGMRVVTTQPEAQWANLAS"
     MSGRFVRIGE TARATVELTI DGEHVAALAG DTLLTAMLCS VRHVRQSEFG NERRAGFCLM        60
     GACQDCWVWT ADGERLRACT TVVEAGMRVV TTQPEAQWAN LAS                         103
//

If you have problems or comments...

PBIL Back to PBIL home page