(data stored in SCRATCH zone)

EMBL: CP000272.PE677

CP000272.PE677       Location/Qualifiers
FT   CDS             complement(737414..738250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0778"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36605"
FT                   /db_xref="GOA:Q13H34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H34"
FT                   /protein_id="ABE36605.1"
FT                   /translation="MIEITNVHKSFGAVPVLKGISLNVRQGEVVCLIGASGSGKSTLLR
FT                   CINALESYDEGEIRLLGQPVEQRARNINQLRTQVGMVFQRFNLFPHRTALENVMEGPVH
FT                   VKRMPRADAQREASELLMKVGLGHKLHAYPNQLSGGQQQRVAIARSLAMKPKAILFDEP
FT                   TSALDPELVGEVLGVMRTLAREGMTMLVVTHEMGFAREVADRVCFLHAGLIIEEGTAQQ
FT                   VLGSPREARTREFLRHVLTNRSDGHDAHDGGAPAGGALSGGAHDDLAPGGVGGAAI"
     MIEITNVHKS FGAVPVLKGI SLNVRQGEVV CLIGASGSGK STLLRCINAL ESYDEGEIRL        60
     LGQPVEQRAR NINQLRTQVG MVFQRFNLFP HRTALENVME GPVHVKRMPR ADAQREASEL       120
     LMKVGLGHKL HAYPNQLSGG QQQRVAIARS LAMKPKAILF DEPTSALDPE LVGEVLGVMR       180
     TLAREGMTML VVTHEMGFAR EVADRVCFLH AGLIIEEGTA QQVLGSPREA RTREFLRHVL       240
     TNRSDGHDAH DGGAPAGGAL SGGAHDDLAP GGVGGAAI                               278
//

If you have problems or comments...

PBIL Back to PBIL home page