(data stored in SCRATCH zone)

EMBL: CP000272.PE678

CP000272.PE678       Location/Qualifiers
FT   CDS             complement(738288..738944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0777"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36606"
FT                   /db_xref="GOA:Q13H33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H33"
FT                   /protein_id="ABE36606.1"
FT                   /translation="MHWHDIVDFVPILIQGAVMSIVITLGCLLLSTVLGLTWALLKMSR
FT                   YPLVVRGVSTMINVVRGLPMIVLLFYIYFVLPEIHIQVSALQASIIGLGFGYSTYVAEI
FT                   FRAGIEAVDPGQYEAAQSIGMGRVKTMVRVILPQAIKVALPPYSNTLVMMLKDSSLAST
FT                   ITVAEMTREGQLIAASTFQNLTVYTLVAIGYLAMSLPLMSMTRTLERRFGRHKAR"
     MHWHDIVDFV PILIQGAVMS IVITLGCLLL STVLGLTWAL LKMSRYPLVV RGVSTMINVV        60
     RGLPMIVLLF YIYFVLPEIH IQVSALQASI IGLGFGYSTY VAEIFRAGIE AVDPGQYEAA       120
     QSIGMGRVKT MVRVILPQAI KVALPPYSNT LVMMLKDSSL ASTITVAEMT REGQLIAAST       180
     FQNLTVYTLV AIGYLAMSLP LMSMTRTLER RFGRHKAR                               218
//

If you have problems or comments...

PBIL Back to PBIL home page