(data stored in ACNUC7421 zone)

EMBL: CP000272.PE679

CP000272.PE679       Location/Qualifiers
FT   CDS             complement(739121..739933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0776"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36607"
FT                   /db_xref="GOA:Q13H32"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H32"
FT                   /protein_id="ABE36607.1"
FT                   /translation="MLRFMFQPASAVRFNAVQRLAAGAGLAMSMMIGAAQVTHGAEAAT
FT                   LTAGSPPSSAPTTFMNVKTQQIEGLMPDVVKEIGKREGFNVSYDAVPFSALIQSVVSGK
FT                   IDIIVAGMTPTARRAEVVDFSQPVTAFGEGIIVKDTNKTNYKSVQDLKGMTVGAPTGTD
FT                   YGDQLKKLGIFTEVKMYDSPADMTRDVALGRIVAGFNDYPILKAQEAAGAMAGTRVDDA
FT                   YVPMEKFDIAVAVKKGNSALLAKINDALTKMKADGSLDAILKKWHLAG"
     MLRFMFQPAS AVRFNAVQRL AAGAGLAMSM MIGAAQVTHG AEAATLTAGS PPSSAPTTFM        60
     NVKTQQIEGL MPDVVKEIGK REGFNVSYDA VPFSALIQSV VSGKIDIIVA GMTPTARRAE       120
     VVDFSQPVTA FGEGIIVKDT NKTNYKSVQD LKGMTVGAPT GTDYGDQLKK LGIFTEVKMY       180
     DSPADMTRDV ALGRIVAGFN DYPILKAQEA AGAMAGTRVD DAYVPMEKFD IAVAVKKGNS       240
     ALLAKINDAL TKMKADGSLD AILKKWHLAG                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page