(data stored in SCRATCH zone)

EMBL: CP000272.PE688

CP000272.PE688       Location/Qualifiers
FT   CDS             749760..750752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0767"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36616"
FT                   /db_xref="GOA:Q13H23"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q13H23"
FT                   /protein_id="ABE36616.1"
FT                   /translation="MEAYPIEVEFPDISAHAAGNTGIAYVHTFDSGVPGPHVMINALTH
FT                   GNEVCGAIAVDGLLKSGLRPRRGTLTLSFANVDAYARFDHASPDKARFVDQDFNRVWTA
FT                   AKLDDVASRSSELDRARAMRPVIDTVDLLLDLHSMHEKSAPLIVAGPLAKGAELSGKLG
FT                   TPATVIQDEGHPEGRRMRDYEGFGDEASAKNALLIECGQHWEASAVTVARDCTARFLLL
FT                   SGVVEAEDLPAGWIVPLSNEMRIVRVTEPVVAKSMDFRFAGPYTGLETFDKAGTVIAWS
FT                   DDQPVATPYDDCMLVMPSLRQLRPGVTVVRLGRIERRIDLTSREQEHAA"
     MEAYPIEVEF PDISAHAAGN TGIAYVHTFD SGVPGPHVMI NALTHGNEVC GAIAVDGLLK        60
     SGLRPRRGTL TLSFANVDAY ARFDHASPDK ARFVDQDFNR VWTAAKLDDV ASRSSELDRA       120
     RAMRPVIDTV DLLLDLHSMH EKSAPLIVAG PLAKGAELSG KLGTPATVIQ DEGHPEGRRM       180
     RDYEGFGDEA SAKNALLIEC GQHWEASAVT VARDCTARFL LLSGVVEAED LPAGWIVPLS       240
     NEMRIVRVTE PVVAKSMDFR FAGPYTGLET FDKAGTVIAW SDDQPVATPY DDCMLVMPSL       300
     RQLRPGVTVV RLGRIERRID LTSREQEHAA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page