(data stored in ACNUC7421 zone)

EMBL: CP000272.PE70

CP000272.PE70        Location/Qualifiers
FT   CDS             complement(80250..81956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0072"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35998"
FT                   /db_xref="GOA:Q13IU1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IU1"
FT                   /protein_id="ABE35998.1"
FT                   /translation="MESNYPPAQTDELAMRAARPADHAAENGVLLRIARAQLGSRERLL
FT                   QEIADAALLLCDAGSSGISLVEGDDQHKQFRWLAVAGLCVGLQGKTTPWRDCPCGVALE
FT                   SAAPQLFVRPQDHFASLRFPGVNITEGLVVPIPTDNGFVGAIWVMSHTPARQFDREDVR
FT                   LLANLAVSAGAALTTVDARDTGEGSERRHSEFIAMLGHELRNPMAPIDSAVGAAKQLCS
FT                   DNEKAVEVLTIAQRQMRHLRTLVDDLLDAARLKHGKLAIKHSNTSLNEIAFDAVTAVRH
FT                   HIESRRHSLKVTGLDEQVPVRADHVRLSQVLGNLLSNAAKYTPTGGTIELTVKVAADEE
FT                   PAQPDLVVIEVKDNGIGIDSSVQPHVFELFAQSARGNARAEGGLGIGLAVAKRMVELHD
FT                   GTISLQSDGSGRGTSVTLRLPILRSRDDSPATVDTAQPRELRPVRLLLVDDNADALQSL
FT                   GMLLELEGHQVTMSASGREAVQLIRQTLPEVAIIDVGMPDMDGFDVATAVRSDSRLDDV
FT                   TLVALTGYAAESDKSRALAAGFDYHLTKPLSLEKLQYILANRAGGKLGGIV"
     MESNYPPAQT DELAMRAARP ADHAAENGVL LRIARAQLGS RERLLQEIAD AALLLCDAGS        60
     SGISLVEGDD QHKQFRWLAV AGLCVGLQGK TTPWRDCPCG VALESAAPQL FVRPQDHFAS       120
     LRFPGVNITE GLVVPIPTDN GFVGAIWVMS HTPARQFDRE DVRLLANLAV SAGAALTTVD       180
     ARDTGEGSER RHSEFIAMLG HELRNPMAPI DSAVGAAKQL CSDNEKAVEV LTIAQRQMRH       240
     LRTLVDDLLD AARLKHGKLA IKHSNTSLNE IAFDAVTAVR HHIESRRHSL KVTGLDEQVP       300
     VRADHVRLSQ VLGNLLSNAA KYTPTGGTIE LTVKVAADEE PAQPDLVVIE VKDNGIGIDS       360
     SVQPHVFELF AQSARGNARA EGGLGIGLAV AKRMVELHDG TISLQSDGSG RGTSVTLRLP       420
     ILRSRDDSPA TVDTAQPREL RPVRLLLVDD NADALQSLGM LLELEGHQVT MSASGREAVQ       480
     LIRQTLPEVA IIDVGMPDMD GFDVATAVRS DSRLDDVTLV ALTGYAAESD KSRALAAGFD       540
     YHLTKPLSLE KLQYILANRA GGKLGGIV                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page