(data stored in SCRATCH zone)

EMBL: CP000272.PE72

CP000272.PE72        Location/Qualifiers
FT   CDS             82361..82870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0074"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36000"
FT                   /db_xref="GOA:Q13IT9"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT9"
FT                   /protein_id="ABE36000.1"
FT                   /translation="MPTKPVVPAPTDELDTVPDTSSPAYATHHPLTRAFDRFASLVTRW
FT                   AGSPAAFCLAVLTVLAWVVTGPIFHYSEGWQLVINTGTTIITFLMVFLIQQSQNKDSVA
FT                   LHLKLNELLSSHRAASNHLIGIEDASEEELRRLAAAYLRLSTKPDTGTAAGGSLTPERT
FT                   GPPTDS"
     MPTKPVVPAP TDELDTVPDT SSPAYATHHP LTRAFDRFAS LVTRWAGSPA AFCLAVLTVL        60
     AWVVTGPIFH YSEGWQLVIN TGTTIITFLM VFLIQQSQNK DSVALHLKLN ELLSSHRAAS       120
     NHLIGIEDAS EEELRRLAAA YLRLSTKPDT GTAAGGSLTP ERTGPPTDS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page