(data stored in ACNUC7421 zone)

EMBL: CP000272.PE77

CP000272.PE77        Location/Qualifiers
FT   CDS             88074..89102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0079"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36005"
FT                   /db_xref="GOA:Q13IT4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT4"
FT                   /protein_id="ABE36005.1"
FT                   /translation="MRGLRTGAGSFALILALAASPVHAGPAAPLNYFLHAAGPAAAPTQ
FT                   RLGWVLSAIAILVTLIIAGLLVGAIVRRRPAPPTRPFNAEAGGMHWIYIGTGVSSIVLL
FT                   AILVYVLITLESVASPAAHPQLTLTVTAYDWWWKVDYADDPDPLRNFSTANEIHIPVGQ
FT                   PVKILLKSADVVHAFWVPQLAGKTQTIPGQTNEQWIQADQPGIFRGQCSQFCGAQHAHM
FT                   AFEVVAQSPADFAAWRAAQGRTAGGSAGDAAVAAGRHLFAERCAGCHTIRGSDAAGLQA
FT                   PDLTHLLSRRTLAAGALTNTPEHLLDWIEHAQRIKPEALMPDIPLTTGDAAALSAYLAT
FT                   LH"
     MRGLRTGAGS FALILALAAS PVHAGPAAPL NYFLHAAGPA AAPTQRLGWV LSAIAILVTL        60
     IIAGLLVGAI VRRRPAPPTR PFNAEAGGMH WIYIGTGVSS IVLLAILVYV LITLESVASP       120
     AAHPQLTLTV TAYDWWWKVD YADDPDPLRN FSTANEIHIP VGQPVKILLK SADVVHAFWV       180
     PQLAGKTQTI PGQTNEQWIQ ADQPGIFRGQ CSQFCGAQHA HMAFEVVAQS PADFAAWRAA       240
     QGRTAGGSAG DAAVAAGRHL FAERCAGCHT IRGSDAAGLQ APDLTHLLSR RTLAAGALTN       300
     TPEHLLDWIE HAQRIKPEAL MPDIPLTTGD AAALSAYLAT LH                          342
//

If you have problems or comments...

PBIL Back to PBIL home page