(data stored in ACNUC7421 zone)

EMBL: CP000272.PE78

CP000272.PE78        Location/Qualifiers
FT   CDS             89132..91174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0080"
FT                   /product="Putative cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36006"
FT                   /db_xref="GOA:Q13IT3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT3"
FT                   /protein_id="ABE36006.1"
FT                   /translation="MAEHAATAATPGTPPRAARDALPDASPLVRTPRRGRVEAGSAEEK
FT                   RLREIWEAPPGWRGWLSTVDHKTIGLRYLVTAFVFLLMGGVEALIMRIQLARPNATVLT
FT                   PEQYDQLFTMHGVTMIFLYALPVLSGFSNYLWPLVLGARDMAFPRLNALSYWVFLFAGI
FT                   FLYASFPAGQAPDAGWFNYAPLSGLEYNTGPNIDVYALGMVLLGISTTVGSMNFVVTLL
FT                   RMRAPGMSLDRIPVLVWGTLTASGGNLLAVPSVSLAFFLLWMDRRIGTHFFDVLNSGRP
FT                   LLWQHLFWIFAHPWVYAVVLPAMGIVSDALPVFCRRPLVGYGPVALSTVATMVIGFVVW
FT                   IHHMFATGIPALALSFFGAASMVIAIPSAVATFAWIATIWTGRPVFRVPFLFFAGFVLL
FT                   FVVGGVSGVLTAAVPFDWQLTDTYFVVAHLHYVLLGINVFPVMGGIYFWFPKFTGRMMS
FT                   ERLGKLGFWVLFIGFNVAFFPMHIAGLLGMPRRIYTYPADMGWNTVNLVTSLGSFLFAA
FT                   GVLIFLIDLLVSLKHGKPAGDNPWDAPTLEWSVSSPPPPYNFAVVPSLASRHPLWEGRI
FT                   DEPDTAFHARSQLDEGYLLAQGREALGTSALEARPDVILKMPADSYAPFWLAVFASLVF
FT                   AGLALSAWIFAGAMLAGCAVSIIVWLWPERALIQREPATVHDAGG"
     MAEHAATAAT PGTPPRAARD ALPDASPLVR TPRRGRVEAG SAEEKRLREI WEAPPGWRGW        60
     LSTVDHKTIG LRYLVTAFVF LLMGGVEALI MRIQLARPNA TVLTPEQYDQ LFTMHGVTMI       120
     FLYALPVLSG FSNYLWPLVL GARDMAFPRL NALSYWVFLF AGIFLYASFP AGQAPDAGWF       180
     NYAPLSGLEY NTGPNIDVYA LGMVLLGIST TVGSMNFVVT LLRMRAPGMS LDRIPVLVWG       240
     TLTASGGNLL AVPSVSLAFF LLWMDRRIGT HFFDVLNSGR PLLWQHLFWI FAHPWVYAVV       300
     LPAMGIVSDA LPVFCRRPLV GYGPVALSTV ATMVIGFVVW IHHMFATGIP ALALSFFGAA       360
     SMVIAIPSAV ATFAWIATIW TGRPVFRVPF LFFAGFVLLF VVGGVSGVLT AAVPFDWQLT       420
     DTYFVVAHLH YVLLGINVFP VMGGIYFWFP KFTGRMMSER LGKLGFWVLF IGFNVAFFPM       480
     HIAGLLGMPR RIYTYPADMG WNTVNLVTSL GSFLFAAGVL IFLIDLLVSL KHGKPAGDNP       540
     WDAPTLEWSV SSPPPPYNFA VVPSLASRHP LWEGRIDEPD TAFHARSQLD EGYLLAQGRE       600
     ALGTSALEAR PDVILKMPAD SYAPFWLAVF ASLVFAGLAL SAWIFAGAML AGCAVSIIVW       660
     LWPERALIQR EPATVHDAGG                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page