(data stored in SCRATCH zone)

EMBL: CP000272.PE80

CP000272.PE80        Location/Qualifiers
FT   CDS             91814..92239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0082"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36008"
FT                   /db_xref="GOA:Q13IT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT1"
FT                   /protein_id="ABE36008.1"
FT                   /translation="MAESVTSPEAPHSPLRYALAGLLLAPLAWLVQMVIAETLAAQSCY
FT                   PFDVPLSAPAMPWMRPALVGVSALCLAAGASGAVIAWRNLRRIARMEKSASGNARPTRT
FT                   ELAGFLSRIAAMCSALFLFALIATDVALAIVSPCRWW"
     MAESVTSPEA PHSPLRYALA GLLLAPLAWL VQMVIAETLA AQSCYPFDVP LSAPAMPWMR        60
     PALVGVSALC LAAGASGAVI AWRNLRRIAR MEKSASGNAR PTRTELAGFL SRIAAMCSAL       120
     FLFALIATDV ALAIVSPCRW W                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page