(data stored in ACNUC7421 zone)

EMBL: CP000272.PE81

CP000272.PE81        Location/Qualifiers
FT   CDS             92242..93663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0083"
FT                   /product="Putative alcohol dehydrogenase cytochrome c
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36009"
FT                   /db_xref="GOA:Q13IT0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IT0"
FT                   /protein_id="ABE36009.1"
FT                   /translation="MRTFRDFVMHRWASVGRRMPRYAGPGLLVALALALAGARVFAANP
FT                   VNASADNGNVANSAPAGADAAEIARGAYLAKAADCAGCHTAAPRVTRPGAAPMLSPPFA
FT                   GGLGMTSPFGTIYSSNITPDPQAGIGRYSYDDFARALRDGVAPGGKRLYPAMPYPSFAR
FT                   ITDDDMHALYAYFMHGVQPVATPAPETRLPFPFNQRWVLMFWDWAFAPRGVFKPEAGRD
FT                   AQWNRGAYLVQSLGHCGACHTPRGPAYEERGYSESSAAYLTGGTNDHWFAPNLTGDRGA
FT                   GLGRSSAADLAAFLRRGHGGGLITFGSMVQVVEDSTQYLNDADLAAIAVYLKSLPPRAE
FT                   SGRFDGRSRAAQQTAQALKTGDVERPGAGIYASYCARCHQMDGAGVPQKYPRLAGNPAV
FT                   LSSSTTSLVRLLVEGGGSPHTQDGPESRKMPSFAARLNDREMAHVLTFIRNTWGNAAAP
FT                   VTAKDVSGVRAALHK"
     MRTFRDFVMH RWASVGRRMP RYAGPGLLVA LALALAGARV FAANPVNASA DNGNVANSAP        60
     AGADAAEIAR GAYLAKAADC AGCHTAAPRV TRPGAAPMLS PPFAGGLGMT SPFGTIYSSN       120
     ITPDPQAGIG RYSYDDFARA LRDGVAPGGK RLYPAMPYPS FARITDDDMH ALYAYFMHGV       180
     QPVATPAPET RLPFPFNQRW VLMFWDWAFA PRGVFKPEAG RDAQWNRGAY LVQSLGHCGA       240
     CHTPRGPAYE ERGYSESSAA YLTGGTNDHW FAPNLTGDRG AGLGRSSAAD LAAFLRRGHG       300
     GGLITFGSMV QVVEDSTQYL NDADLAAIAV YLKSLPPRAE SGRFDGRSRA AQQTAQALKT       360
     GDVERPGAGI YASYCARCHQ MDGAGVPQKY PRLAGNPAVL SSSTTSLVRL LVEGGGSPHT       420
     QDGPESRKMP SFAARLNDRE MAHVLTFIRN TWGNAAAPVT AKDVSGVRAA LHK              473
//

If you have problems or comments...

PBIL Back to PBIL home page