(data stored in ACNUC7421 zone)

EMBL: CP000272.PE82

CP000272.PE82        Location/Qualifiers
FT   CDS             complement(93861..96155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0084"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36010"
FT                   /db_xref="GOA:Q13IS9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS9"
FT                   /protein_id="ABE36010.1"
FT                   /translation="MSTAHKDSDAYQHASGGWGSLKAVASALIQEKAPVETSRVLVHQN
FT                   KPDGFMCVSCSWAKPAHPHTFEFCESGAKATAWDLTSRRVNPEFFQQHTLAELEQWHDQ
FT                   ALEDAGRLCAPMRWDAALDKYVEVTWEHAFAEIGRELRAIKPDEAVFYTSGRASLETAY
FT                   MYQLFARMYGTNNLPDSSNMCHESTSVGLKQAIGVGVGTITLEDFKHTDLMFFFGQNVG
FT                   TNSPRMLHDLQEARERGVPIITFNPIREPGLVSFVNPQSPTQMLKPGATQISTQYHQLK
FT                   AGGDSAAIVGICKAVIEADDRAQATGAARIVDAGFIAEHTSGFDDFARYVRNARWDELE
FT                   RICGLTRAALTAAADEYMRAKAVIIHYGMGLTQHRMGVQNVRMIVNLLLLRGNIGKPGA
FT                   GPSPIRGHSNVQGQRTVGVTEKPELAPLDKLAEQYHFTPPRKEGMATVDACKGVIDGKV
FT                   RAVFQLGGNLVRSVPDRYAIEPAWRKLRLTVSIATKLNRSHLVHGEVSYLLPCLSRIEI
FT                   DERMGNAQAVAMEDSTGCMHGSHGVAQPASDQLLSEPAIVAGIAKAALDSTSVDWDAWS
FT                   NDYALVRDAIAETYPEIFHDFNARMWTPGGFHRPLPARERKWETKSGKAEFMVPQTLNE
FT                   DPDMPERQPDDLRLFTLRSDSQFNTTIYTLDDRFRGVRGTRMVLLMNRRDIERHGLEAD
FT                   AEVSLEAVSPDGIPRRVDGFRIMEFDLPAGCVAGYYPECNPLIPLSHHAKESKVPAAKA
FT                   IPVRIVAAQTV"
     MSTAHKDSDA YQHASGGWGS LKAVASALIQ EKAPVETSRV LVHQNKPDGF MCVSCSWAKP        60
     AHPHTFEFCE SGAKATAWDL TSRRVNPEFF QQHTLAELEQ WHDQALEDAG RLCAPMRWDA       120
     ALDKYVEVTW EHAFAEIGRE LRAIKPDEAV FYTSGRASLE TAYMYQLFAR MYGTNNLPDS       180
     SNMCHESTSV GLKQAIGVGV GTITLEDFKH TDLMFFFGQN VGTNSPRMLH DLQEARERGV       240
     PIITFNPIRE PGLVSFVNPQ SPTQMLKPGA TQISTQYHQL KAGGDSAAIV GICKAVIEAD       300
     DRAQATGAAR IVDAGFIAEH TSGFDDFARY VRNARWDELE RICGLTRAAL TAAADEYMRA       360
     KAVIIHYGMG LTQHRMGVQN VRMIVNLLLL RGNIGKPGAG PSPIRGHSNV QGQRTVGVTE       420
     KPELAPLDKL AEQYHFTPPR KEGMATVDAC KGVIDGKVRA VFQLGGNLVR SVPDRYAIEP       480
     AWRKLRLTVS IATKLNRSHL VHGEVSYLLP CLSRIEIDER MGNAQAVAME DSTGCMHGSH       540
     GVAQPASDQL LSEPAIVAGI AKAALDSTSV DWDAWSNDYA LVRDAIAETY PEIFHDFNAR       600
     MWTPGGFHRP LPARERKWET KSGKAEFMVP QTLNEDPDMP ERQPDDLRLF TLRSDSQFNT       660
     TIYTLDDRFR GVRGTRMVLL MNRRDIERHG LEADAEVSLE AVSPDGIPRR VDGFRIMEFD       720
     LPAGCVAGYY PECNPLIPLS HHAKESKVPA AKAIPVRIVA AQTV                        764
//

If you have problems or comments...

PBIL Back to PBIL home page